Telefone:
China pós esteróides crus fabricante
Zhuhai Jiacheng Bio-Tech Co., Ltd.

Zhuhai Jiacheng Biotech Co., Ltd.

 

Forneça intermediários farmacêuticos domésticos de Europe& America do Norte, hormonas esteroides, Trenbolone Enanthate, testosterona Enanthate para o uso do halterofilismo.

Casa Produtospós esteróides crus

Pós esteroides crus cristalinos esbranquiçados/hormona crescimento do músculo para o halterofilismo do envio dos EUA

Pós esteroides crus cristalinos esbranquiçados/hormona crescimento do músculo para o halterofilismo do envio dos EUA

    • Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping
    • Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping
  • Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping

    Detalhes do produto:

    Lugar de origem: Guangdong, China
    Marca: KA-XING
    Certificação: HPLC and COA
    Número do modelo: 315-37-7
    Tipo: esteróide do halterofilismo

    Condições de Pagamento e Envio:

    Quantidade de ordem mínima: 50g
    Preço: Negotiated
    Detalhes da embalagem: 5g, 50g, 100g, 500g, saco 1kg/foil ou como exigências
    Tempo de entrega: 3 dias por DHL
    Termos de pagamento: T/T, Moneygram, Bitcoins
    Habilidade da fonte: 1T/month
    Entre em contacto agora
    Descrição de produto detalhada
    cor: pó cristalino esbranquiçado CAS: 315-37-7
    Grau: Carnitina farmacêutica da categoria Use: crescimento do músculo
    usuários: Halterofilistas

     
    CJC-1295 sem o DAC dos Peptides
    detalhe 1.Quick:
     
    Nome do produto: CJC-1295
    Nome inglês: CJC-1295 (sem DAC)
    Número de CAS: 863288-34-0
    Lys-Val-Leu-Alá-Gln-Leu-Ser-Alá-Arg-Lys-Leu-leu-Tyr Gln-Asp-Ile-Leu-Ser-Arg-NH2
    Fórmula molecular: C152H252N44O42
    Peso molecular: 3367,97
    Pureza: 98%
    Traços: pó branco
     
    CJC-1295 sem DAC, um amino peptide 29 ácido com sequência Y (a Dinamarca) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, é um analogue tetrasubstituted do peptide de GHRH com substituições de D-Alá, de Gln, de Alá, e de leu nas posições 2, 8, 15, e 27 respectivamente que podem fazer o peptide mais estável. Uma de suas vantagens sobre GHRH tradicional é sua capacidade ao bioconjugate com albumina de soro, assim aumentando suas meia-vida e janela terapêutica. Realiza esta usando grupos de proteção em torno dos ácidos aminados de GHRH tipicamente susceptível à degradação enzimático. Na pesquisa clínica, o objetivo do peptide era tratar depósitos gordos viscerais em pacientes obesos do SIDA, como os níveis aumentados de HGH exógeno são presumidos aumentar a lipólise (perda gorda).
     2 como CJC-1295 trabalha
    CJC-1295 atua durante mais tempo do que GRF puro. Atua na glândula pituitária e mantém-se estimular a liberação da hormona de crescimento nos pulsos. O peptide então encontra uma unidade neucleophilic dentro do sangue e reage com ele a fim criar uma ligação mais firme. A razão pela qual atua nos pulsos é porque a linha central da hormona de crescimento humano controla quanto da hormona pode permanecer no corpo em um momento. Isto mantém o ambiente homeostático no corpo.


     efeito 3.The;
     

    Para a gordo-perda, halterofilismo, reparo de ferimento: Doses múltiplas, junto com o exercício e uma dieta apropriada. Isto reduzirá níveis da gordura e adicioná-los-á à massa do músculo.

     
    Pós esteroides crus cristalinos esbranquiçados/hormona crescimento do músculo para o halterofilismo do envio dos EUA
     
    4. Empacotamento & entrega:
     
    Empacotamento prudente
     
     
    cláusula 5.Commerce:
     
    Quantidade de ordem mínima: 100g
    Prazo de entrega: 3 dias
    Termos do pagamento: TT, Moneygram e Western Union, Bitcoin, dinheiro.
    sócio do transporte: DHL, UPS, TNT, FEDEX, HKEMS
     
     
    vantagens 6.Our:
    a empresa 1.Our é uma fábrica principal da produção profissional em China na área farmacêutica de 20years, nossos produtos exportaram para Alemanha, Espanha, Reino Unido, EUA, Austrália, Médio Oriente, e assim por diante o outro país, e nós obtivemos o feedback muito bom de nossos clientes, nós tínhamos estabelecido relações amigáveis longas da cooperação
    2. Preço de alta qualidade, melhor, serviço de primeira classe, taxa bem sucedida alta da entrega
    3. Nós temos o estoque em China, Europa, Canadá, assim que nós podemos entrega rapidamente no dia mesmo em que receba o pagamento
    Setails do contato:
    E-mail: jxkchen@gmail.com
    Skype: linwenchen88
    http://www.raw-steroid-powders.com
     
     
     

    Polipeptídeo
    NÃO. Nome especificação
    T-A001 MGF 2mg
    T-A002 MGF DO PEG 2mg
    T-A003 CJC-1295 com DAC 2mg
    T-A004 CJC-1295 sem DAC 2mg
    T-A005 PT-141 10mg
    T-A006 MT-1 10mg
    T-A007 MT-2 10mg
    T-A008 GHRP-2 5mg
    T-A008 GHRP-2 10mg
    T-A009 GHRP-6 5mg
    T-A009 GHRP-6 10mg
    T-A010 Ipamorelin 2mg
    T-A011 Hexarelin 2mg
    T-A012 Sermorelin 2mg
    T-A013 Oxytocin 2mg
    T-A014 TB500 2mg
    T-A015 pentadecapeptide BPC 157 2mg
    T-A016 HGH 176-191 2mg
    T-A017 Triptorelin 2mg
    T-A018 Tesamorelin 2mg
    T-A020 Gonadorelin 2mg
    T-A020 Gonadorelin 10mg
    T-A021 DSIP 2mg
    T-A022 Selank 5mg
         
         
      HGH jogo 200iu
      HGH jogo 100iu
      HCG tubo de ensaio 5000iu
         

     
     

    SARMS
    Nome CAS NÃO.
    Ostarine, MK-2866, Enobosarm 841205-47-8
    Andarine (S-4) 401900-40-1
    MK-677, Ibutamoren, mesylate 159752-10-0
    LGD-4033 1165910-22-4
    GW-501516/Cardarine 317318-70-0
    AICAR 2627-69-2
    SR9009 137986-29-9
    RAD-140 118237-47-0
    Flibanserin 167933-07-5
    Carphedon 77472-70-9
    Coluracetam 135463-81-9
    Sunifiram 314728-85-3
    Adrafinil 63547-13-7
    Pirfenidone 53179-13-8
    YK11 1370003-76-1
       
    ACE-031  

    Contacto
    Zhuhai Jiacheng Bio-Tech Co., Ltd.

    Pessoa de Contato: yuansen

    Envie sua pergunta diretamente para nós (0 / 3000)

    Zhuhai Jiacheng Bio-Tech Co., Ltd.
    A sala C, 2ó assoalho, obstrui 3 que o La menciona, Areia Preta, Macau
    Privacy Policy China de boa qualidade Raw Steroid Powders fornecedor. Copyright © 2014 - 2019 raw-steroid-powders.com. All Rights Reserved.